Recombinant Mouse Il1a protein

• Cat.No.: Il1a-545M
• Product Overview: Recombinant Mouse Il1a protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 156
• Description: Interleukin-1 alpha (IL-1α) is a non-secreted proinflammatory cytokine produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. Both IL-1α and IL-1β binds to the same receptor and has similar if not identical biological properties. Among various species,the amino acid sequence of mature IL-1α s conserved 60 % to 70 % and human IL1 has been found to be biologically active on murine cell lines .
• Form: Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 2 pg/ml, corresponding to a specific activity of > 5.0 × 10⁸ IU/mg.
• Molecular Mass: Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
• AA Sequence: SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
• Endotoxin: Less than 1 EU/µg of rMuIL-1α as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Il1a
• Official Symbol: Il1a
• Synonyms: IL1A; interleukin 1 alpha; interleukin-1 alpha; IL-1 alpha; Il-1a
• Gene ID: 16175
• mRNA Refseq: NM_010554
• Protein Refseq: NP_034684
• UniProt ID: Q3U0Y6