Recombinant Mouse IL17A Protein
Cat.No. : | IL17A-508M |
Product Overview : | Recombinant Mouse IL17A protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Protein Length : | 158 |
Description : | This gene encodes a pro-inflammatory cytokine that is a member of the interleukin-17 family. The encoded protein plays a central role in host defense against diverse pathogens. The encoded protein is produced by activated T-cells and certain cell types of innate immune system. The active protein functions as either a homodimer with other interleukin-17 family members and signals through the interleukin-17 receptor to induce inflammatory cytokine production. Aberrant expression of this gene is associated with autoinflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. |
Form : | Lyophilized |
AA Sequence : | MSPGRASSVSLMLLLLLSLAATVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Il17a interleukin 17A [ Mus musculus (house mouse) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A; |
Gene ID | 16171 |
mRNA Refseq | NM_010552 |
Protein Refseq | NP_034682 |
UniProt ID | Q62386 |
◆ Recombinant Proteins | ||
IL17A-279H | Recombinant Human Interleukin 17A, Fc Chimera | +Inquiry |
IL17A-570H | Active Recombinant Human Interleukin 17A, MIgG2a Fc-tagged | +Inquiry |
IL17A-333H | Active Recombinant Human IL17A | +Inquiry |
Il17a-149M | Recombinant Active Mouse IL17A Protein, His-tagged(C-ter) | +Inquiry |
IL17A-153M | Recombinant Marmoset IL17A | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket