Recombinant Human IL13 Protein, His-tagged

• Cat.No.: IL13-120H
• Product Overview: Recombinant Human Interleukin-13 is produced by our Mammalian expression system and the target gene encoding Leu25-Asn146 is expressed with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: Leu25-Asn146
• Description: Interleukin-13 is also known as IL-13. It is a protein that in humans is encoded by the IL13 gene. Interleukin-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells.It is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4.
• AA Sequence: LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIE KTQRMLSGFCPHKVS AGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFNVDHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Dissolve the lyophilized protein in distilled water.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL13 interleukin 13 [ Homo sapiens (human) ]
• Official Symbol: IL13
• Synonyms: Interleukin-13; IL-13; P600
• Gene ID: 3596
• mRNA Refseq: NM_001354991.2
• Protein Refseq: NP_001341920.1
• MIM: 147683
• UniProt ID: P35225