Recombinant Mouse IL10 Protein

• Cat.No.: IL10-115M
• Product Overview: Recombinant Mouse Interleukin-10 is produced by our E.coli expression system and the target gene encoding Ser19-Ser178 is expressed.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: Ser19-Ser178
• Description: Mouse Il10 is the prototypic member of the IL-10 cytokine family, including IL-10, IL-19, IL-20, IL-22 (IL-TIF), IL-24 and IL-26. Many viruses encode viral members of the IL-10 family, such as Epstein-Barr virus (EBV) and human cytomegalovirus (HCMV).Its main function is inhibiting the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells. Although human and mouse IL-10 are 81% identical at the nucleotide and amino acid level, mouse IL-10 is species-specific and does not act on human cells. Interestingly, Human IL-10 is active on mouse cells.
• Form: Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
• AA Sequence: MSRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQ FYLVEVMPQAE KHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAY MMIKMKS
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Dissolve the lyophilized protein in distilled water.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: Il10 interleukin 10 [ Mus musculus (house mouse) ]
• Official Symbol: IL10
• Synonyms: Interleukin-10; IL-10; Cytokine synthesis inhibitory factor; CSIF; If2a
• Gene ID: 16153
• mRNA Refseq: NM_010548.2
• Protein Refseq: NP_034678.1
• UniProt ID: P18893