Recombinant Rhesus macaque IL10 protein, C-terminal 10xHis-tagged-tagged
Cat.No. : | IL10-2232R |
Product Overview : | Recombinant Rhesus macaque IL10 protein(P51496)(19-178aa), fused to C-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 19-178aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.2 kDa |
AA Sequence : | SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
Il10-328M | Active Recombinant Mouse Il10, Fc-tagged | +Inquiry |
IL10-2049R | Recombinant Rhesus Macaque IL10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il10-1657R | Recombinant Rat Il10 Protein, His-tagged | +Inquiry |
Il10-17S | Recombinant Swine Il10 | +Inquiry |
IL10-16H | Recombinant Human IL10 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket