Recombinant Rhesus monkey IL10 protein, His-tagged

• Cat.No.: IL10-20R
• Product Overview: Recombinant Rhesus monkey IL10 protein is produced by E.coli expression system and is fused with a His tag at the N-terminal.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: His
• Protein Length: Ser19-Asn178
• Form: 100 mM NaHCO3, 500 mM NaCl, pH 8.3, containing 1 mM EDTA, 1 mM DTT, 0.01 % SKL, 5 % Trehalose and Proclin 300.
• Molecular Mass: 23 kDa
• AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 90 %, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
• Notes: Avoid repeated freeze/thaw cycles.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48 h, and no obvious degradation and precipitation were observed. The loss rate is less than 5 % within the expiration date under appropriate storage condition.
• Storage: Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
• Reconstitution: Reconstitute in 100mM NaHCO3, 500mM NaCl (pH8.3) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: IL10 interleukin 10 [ Macaca mulatta ]
• Official Symbol: IL10
• Synonyms: CSIF; IL10A; TGIF; Cytokine Synthesis Inhibitory Factor; interleukin 10
• Gene ID: 694931
• mRNA Refseq: NM_001044727
• Protein Refseq: NP_001038192