Recombinant Mouse Hmox1 protein, His-B2M-tagged

• Cat.No.: Hmox1-3041M
• Product Overview: Recombinant Mouse Hmox1 protein(P14901)(1-289aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Mouse
• Tag: His&B2M
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.9 kDa
• Protein length: 1-289aa
• AA Sequence: MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Hmox1 heme oxygenase (decycling) 1 [ Mus musculus ]
• Official Symbol: Hmox1
• Synonyms: HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; P32 protein; hemoxygenase; HO1; HO-1; Hmox; Hemox; Hsp32; D8Wsu38e
• Gene ID: 15368
• mRNA Refseq: NM_010442
• Protein Refseq: NP_034572