Recombinant Human HMOX1 protein, His-tagged
Cat.No. : | HMOX1-3040H |
Product Overview : | Recombinant Human HMOX1 protein(P09601)(3-288aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3-288aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | RPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HMOX1 heme oxygenase (decycling) 1 [ Homo sapiens ] |
Official Symbol | HMOX1 |
Synonyms | HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; bK286B10; HO 1; heat shock protein, 32-kD; HO-1; HSP32; |
Gene ID | 3162 |
mRNA Refseq | NM_002133 |
Protein Refseq | NP_002124 |
MIM | 141250 |
UniProt ID | P09601 |
◆ Recombinant Proteins | ||
Hmox1-1557R | Recombinant Rat Hmox1 protein, His-tagged | +Inquiry |
HMOX1-277H | Recombinant Human HMOX1 protein, His/MBP-tagged | +Inquiry |
HMOX1-061H | Recombinant Human HMOX1 Protein, His-tagged | +Inquiry |
HMOX1-1597H | Recombinant Human Heme Oxygenase (decycling) 1, GST-tagged | +Inquiry |
HMOX1-27877TH | Recombinant Human HMOX1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMOX1 Products
Required fields are marked with *
My Review for All HMOX1 Products
Required fields are marked with *
0
Inquiry Basket