Recombinant Human HMOX1 protein, His-tagged

• Cat.No.: HMOX1-3040H
• Product Overview: Recombinant Human HMOX1 protein(P09601)(3-288aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.6 kDa
• Protein length: 3-288aa
• AA Sequence: RPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HMOX1 heme oxygenase (decycling) 1 [ Homo sapiens ]
• Official Symbol: HMOX1
• Synonyms: HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; bK286B10; HO 1; heat shock protein, 32-kD; HO-1; HSP32
• Gene ID: 3162
• mRNA Refseq: NM_002133
• Protein Refseq: NP_002124
• MIM: 141250
• UniProt ID: P09601