Recombinant Mouse Hmgb1 protein, His-tagged
Cat.No. : | Hmgb1-4308M |
Product Overview : | Recombinant Mouse Hmgb1 protein(P63158)(2-215aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-215aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.7 kDa |
AA Sequence : | GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Hmgb1 high mobility group box 1 [ Mus musculus ] |
Official Symbol | Hmgb1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group protein B1; high mobility group protein 1; DEF; p30; Hmg1; HMG-1; SBP-1; amphoterin; MGC103168; MGC103169; MGC117896; MGC117897; |
Gene ID | 15289 |
mRNA Refseq | NM_010439 |
Protein Refseq | NP_034569 |
◆ Recombinant Proteins | ||
Hmgb1-4051M | Recombinant Mouse Hmgb1 Protein (Met1-Glu215), N-His tagged | +Inquiry |
Hmgb1-01M | Active Recombinant Mouse Hmgb1 Protein, His-Tagged | +Inquiry |
HMGB1-017H | Recombinant Human HMGB1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HMGB1-3077H | Recombinant Human HMGB1 Protein (Met1-Glu215), N-His tagged | +Inquiry |
HMGB1-454H | Recombinant Human HMGB1 protein(Met 1-Glu 215), His&hFc-tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hmgb1 Products
Required fields are marked with *
My Review for All Hmgb1 Products
Required fields are marked with *
0
Inquiry Basket