Recombinant Mouse Hist1h2ba protein, His&Myc-tagged

• Cat.No.: Hist1h2ba-3030M
• Product Overview: Recombinant Mouse Hist1h2ba protein(P70696)(2-127aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-127aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.5 kDa
• AA Sequence: PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Hist1h2ba histone cluster 1, H2ba [ Mus musculus ]
• Official Symbol: Hist1h2ba
• Synonyms: HIST1H2BA; histone cluster 1, H2ba; histone H2B type 1-A; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; Th2b
• Gene ID: 319177
• mRNA Refseq: NM_175663
• Protein Refseq: NP_783594