Recombinant Mouse Hist1h2ba protein, His&Myc-tagged

Cat.No. : Hist1h2ba-3030M
Product Overview : Recombinant Mouse Hist1h2ba protein(P70696)(2-127aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 2-127aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 21.5 kDa
AA Sequence : PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Hist1h2ba histone cluster 1, H2ba [ Mus musculus ]
Official Symbol Hist1h2ba
Synonyms HIST1H2BA; histone cluster 1, H2ba; histone H2B type 1-A; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; Th2b;
Gene ID 319177
mRNA Refseq NM_175663
Protein Refseq NP_783594

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Hist1h2ba Products

Required fields are marked with *

My Review for All Hist1h2ba Products

Required fields are marked with *

0

Inquiry Basket

cartIcon