Recombinant Human HIST1H2BA Protein, GST-tagged

Cat.No. : HIST1H2BA-4785H
Product Overview : Human HIST1H2BA full-length ORF (BAG34991.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
Molecular Mass : 40.37 kDa
AA Sequence : MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H2BA histone cluster 1, H2ba [ Homo sapiens ]
Official Symbol HIST1H2BA
Synonyms HIST1H2BA; histone cluster 1, H2ba; H2B histone family, member U, (testis specific) , histone 1, H2ba; histone H2B type 1-A; bA317E16.3; H2BFU; STBP; TSH2B; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; H2B histone family, member U, (testis-specific);
Gene ID 255626
mRNA Refseq NM_170610
Protein Refseq NP_733759
MIM 609904
UniProt ID Q96A08

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIST1H2BA Products

Required fields are marked with *

My Review for All HIST1H2BA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon