Recombinant Mouse H2-K1 protein, His-tagged

Cat.No. : H2-K1-406M
Product Overview : Recombinant Mouse H2-K1 protein(P01901)(22-305aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 22-305aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.6 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNM
Gene Name H2-K1 histocompatibility 2, K1, K region [ Mus musculus ]
Official Symbol H2-K1
Synonyms H2-K1; histocompatibility 2, K1, K region; H-2 class I histocompatibility antigen, K-W28 alpha chain; H-2K(B); H-2K(K); H-2K(Q); MHC class I antigen; MHC class I heavy chain H2-K; MHC H2-K transplantation antigen; class I major histocompatibility antigen H-2Kd; MHC class I H2-K-b-alpha-2 cell surface glycoprotein; H-2 class I histocompatibility antigen, K-B alpha chain; H-2 class I histocompatibility antigen, K-D alpha chain; H-2 class I histocompatibility antigen, K-K alpha chain; H-2 class I histocompatibility antigen, K-Q alpha chain; K-f; H-2K; H2-K; H-2K(d); MGC7052; MGC184092;
Gene ID 14972
mRNA Refseq NM_001001892
Protein Refseq NP_001001892

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All H2-K1 Products

Required fields are marked with *

My Review for All H2-K1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon