Recombinant Mouse H2-K1 protein, GST-tagged

• Cat.No.: H2-K1-4096M
• Product Overview: Recombinant Mouse H2-K1 protein(P01902)(22-305aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: GST
• Protein Length: 22-305aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 60 kDa
• AA Sequence: GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: H2-K1 histocompatibility 2, K1, K region [ Mus musculus ]
• Official Symbol: H2-K1
• Synonyms: H2-K1; histocompatibility 2, K1, K region; H-2 class I histocompatibility antigen, K-W28 alpha chain; H-2K(B); H-2K(K); H-2K(Q); MHC class I antigen; MHC class I heavy chain H2-K; MHC H2-K transplantation antigen; class I major histocompatibility antigen H-2Kd; MHC class I H2-K-b-alpha-2 cell surface glycoprotein; H-2 class I histocompatibility antigen, K-B alpha chain; H-2 class I histocompatibility antigen, K-D alpha chain; H-2 class I histocompatibility antigen, K-K alpha chain; H-2 class I histocompatibility antigen, K-Q alpha chain; K-f; H-2K; H2-K; H-2K(d); MGC7052; MGC184092
• Gene ID: 14972
• mRNA Refseq: NM_001001892
• Protein Refseq: NP_001001892