Recombinant Mouse H2-K1 protein, GST-tagged
Cat.No. : | H2-K1-4096M |
Product Overview : | Recombinant Mouse H2-K1 protein(P01902)(22-305aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-305aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 60 kDa |
AA Sequence : | GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | H2-K1 histocompatibility 2, K1, K region [ Mus musculus ] |
Official Symbol | H2-K1 |
Synonyms | H2-K1; histocompatibility 2, K1, K region; H-2 class I histocompatibility antigen, K-W28 alpha chain; H-2K(B); H-2K(K); H-2K(Q); MHC class I antigen; MHC class I heavy chain H2-K; MHC H2-K transplantation antigen; class I major histocompatibility antigen H-2Kd; MHC class I H2-K-b-alpha-2 cell surface glycoprotein; H-2 class I histocompatibility antigen, K-B alpha chain; H-2 class I histocompatibility antigen, K-D alpha chain; H-2 class I histocompatibility antigen, K-K alpha chain; H-2 class I histocompatibility antigen, K-Q alpha chain; K-f; H-2K; H2-K; H-2K(d); MGC7052; MGC184092; |
Gene ID | 14972 |
mRNA Refseq | NM_001001892 |
Protein Refseq | NP_001001892 |
◆ Recombinant Proteins | ||
H2-K1-4096M | Recombinant Mouse H2-K1 protein, GST-tagged | +Inquiry |
H2-K1-406M | Recombinant Mouse H2-K1 protein, His-tagged | +Inquiry |
H2-K1-5683M | Recombinant Mouse H2-K1 Protein (Full Length), Avi tagged | +Inquiry |
H2-K1-3172 | Recombinant H2-K1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2-K1 Products
Required fields are marked with *
My Review for All H2-K1 Products
Required fields are marked with *
0
Inquiry Basket