Recombinant Mouse GUSB Protein

Cat.No. : Ccn4-593M
Product Overview : Recombinant Mouse GUSB Protein Cys216~Arg347 (Accession # O95388) with N-terminal His Tag was expressed in E.coli.
Availability April 22, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 216-347 a.a.
Description : Broad expression in limb E14.5 (RPKM 9.0), ovary adult (RPKM 6.7) and 17 other tissues.
Form : Freeze-dried powder
Molecular Mass : 16.3kDa
AA Sequence : MGHHHHHHSGSEFCIAYTSPWSPCSTTCGLGISTRISNVNARCWPEQESRLCNLRPCDVDIQLHIKAGKKCLAVYQPEEATNFTLAGCVSTRTYRPKYCGVCTDNRCCIPYKSKTISVDFQCPEGPGFSRQVLWINACFCNLSCR
Endotoxin : <1.0 EU per 1 µg (determined by the LAL method)
Purity : >95%
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Stability : The thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48 h, and no obvious degradation and precipitation were observed. (Referring from China Biological Products Standard, which was calculated by the Arrhenius equation.) The loss of this protein is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles.
Store at 2-8 centigrade for one month.
Aliquot and store at -80 centigrade for 12 months.
Storage Buffer : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Reconstitution : Reconstitute in sterile PBS, pH7.2 - pH7.4.
Gene Name Ccn4 cellular communication network factor 4 [ Mus musculus (house mouse) ]
Official Symbol Ccn4
Synonyms Ccn4; cellular communication network factor 4; Elm1; Wisp1; AW146261; WNT1-inducible-signaling pathway protein 1; CCN family member 4; WNT1 inducible signaling pathway protein 1
Gene ID 22402
mRNA Refseq NM_018865
Protein Refseq NP_061353
UniProt ID O54775

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccn4 Products

Required fields are marked with *

My Review for All Ccn4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon