Recombinant Mouse Fgf9 protein

• Cat.No.: Fgf9-669M
• Product Overview: Recombinant Mouse Fgf9 protein was expressed in Escherichia coli.

Specification

• Description: Fibroblast growth factor 9 (FGF-9) encoded by the FGF-9 gene is a member of the fibroblast growth factor (FGF) family. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In addition, this protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells and it is a heparin-binding protein. Furthermore, FGF-9 is a monomer and interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Recombinant mouse FGF-9 is synthesized as a 208 a.a. precursor that contains a 3 a.a. signal sequence. Specifically, The mouse FGF-9 shares 99 % a.a. sequence identity with rat FGF-9.
• Source: E.coli
• Species: Mouse
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM Tris, 500 mM NaCl, pH 8.5.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 23.4 kDa, a single non-glycosylated polypeptide chain containing 207 amino acids.
• Protein length: 207
• AA Sequence: MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: Less than 1 EU/µg of rMuFGF-9 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Fgf9
• Official Symbol: Fgf9
• Synonyms: FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks
• Gene ID: 14180
• mRNA Refseq: NM_013518
• Protein Refseq: NP_038546
• UniProt ID: P54130