Active Recombinant Mouse Fgf9 Protein (207 aa)

Cat.No. : Fgf9-405F
Product Overview : Recombinant mouse Fibroblast Growth Factor (rmFGF-9) produced in E. coli is a single non-glycosylated polypeptide chain containing 207 amino acids. A fully biologically active molecule, rmFGF-9 has a molecular mass of 23.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 207
Description : Fibroblast Growth Factor-9 (FGF-9) is a pleiotropic cytokine and belongs to the heparin-binding FGF family. Like other members in the family, FGF-9 resembles a β-trefoil structure. FGF-9 undergoes reversible dimerization, a common characteristic shared by its subfamily members, FGF-16 and FGF-20. The mutations involved in the homodimerization also affect the affinity for heparin, binding to FGF receptors, and biological activity. In vivo, FGF-9 is expressed in limb buds, the developing skeleton, and in the intestines during late stage embryogenesis. FGF-9 is essential for the development of heart, lung, kidney, cecum, and testes; and the reduction of FGF-9 level leads to premature differentiation. FGF-9 also works along with Bone Morphogenetic Protein-7 (BMP-7) to promote the survival of nephron progenitors.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
Molecular Mass : 23.4 kDa, observed by reducing SDS-PAGE.
AA Sequence : MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant mouse Fibroblast Growth Factor (rmFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-9 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Fgf9 fibroblast growth factor 9 [ Mus musculus ]
Official Symbol Fgf9
Synonyms FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks;
Gene ID 14180
mRNA Refseq NM_013518
Protein Refseq NP_038546
UniProt ID P54130

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Fgf9 Products

Required fields are marked with *

My Review for All Fgf9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon