Active Recombinant Mouse Fgf9 Protein (207 aa)

• Cat.No.: Fgf9-405F
• Product Overview: Recombinant mouse Fibroblast Growth Factor (rmFGF-9) produced in E. coli is a single non-glycosylated polypeptide chain containing 207 amino acids. A fully biologically active molecule, rmFGF-9 has a molecular mass of 23.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 207
• Description: Fibroblast Growth Factor-9 (FGF-9) is a pleiotropic cytokine and belongs to the heparin-binding FGF family. Like other members in the family, FGF-9 resembles a β-trefoil structure. FGF-9 undergoes reversible dimerization, a common characteristic shared by its subfamily members, FGF-16 and FGF-20. The mutations involved in the homodimerization also affect the affinity for heparin, binding to FGF receptors, and biological activity. In vivo, FGF-9 is expressed in limb buds, the developing skeleton, and in the intestines during late stage embryogenesis. FGF-9 is essential for the development of heart, lung, kidney, cecum, and testes; and the reduction of FGF-9 level leads to premature differentiation. FGF-9 also works along with Bone Morphogenetic Protein-7 (BMP-7) to promote the survival of nephron progenitors.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 ng/mL, measured by a cell proliferation assay using 3T3 cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
• Molecular Mass: 23.4 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant mouse Fibroblast Growth Factor (rmFGF-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-9 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Fgf9 fibroblast growth factor 9 [ Mus musculus ]
• Official Symbol: Fgf9
• Synonyms: FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks
• Gene ID: 14180
• mRNA Refseq: NM_013518
• Protein Refseq: NP_038546
• UniProt ID: P54130