Recombinant Mouse Fgf18 protein

Cat.No. : Fgf18-562M
Product Overview : Recombinant Mouse Fgf18 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 180
Description : Murine FGF-18 is encoded by the FGF18 gene. By phylogenetic analysis and gene location analysis, FGF-18 is divided into FGF-8 subfamily which has three members FGF-8, FGF-17 and FGF-18. Using FGF knockout mice model, the numbers of this subfamily were testified that have crucial roles of in embryo development. FGF-18–/– mice have decreased expression of osteogenic markers and delayed long-bone ossification. FGF-18 has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. In addition, it also has significant roles in lung development and has an anabolic effect on cartilage formation.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 500 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 21.0 kDa, a single non-glycosylated polypeptide chain containing 180 amino acids.
AA Sequence : EENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG
Endotoxin : Less than 1 EU/µg of rMuFGF-18 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Fgf18
Official Symbol Fgf18
Synonyms FGF18; fibroblast growth factor 18; zFGF5; FGF-18; D130055P09Rik;
Gene ID 14172
mRNA Refseq NM_008005
Protein Refseq NP_032031
UniProt ID O89101

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Fgf18 Products

Required fields are marked with *

My Review for All Fgf18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon