Active Recombinant Human FGF18 Protein (174 aa)
Cat.No. : | FGF18-418F |
Product Overview : | Recombinant human Fibroblast Growth Factor-18 (rhFGF-18) produced in E. coli is a single non-glycosylated polypeptide chain containing 174 amino acids. A fully biologically active molecule, rhFGF-18 has a molecular mass of 20.3 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 174 |
Description : | Fibroblast Growth Factor-18 (FGF-18) is a heparin-binding growth factor that is a member of the FGF family. FGF-18 signals through FGFR 1c, 2c, 3c, and 4. FGF-18 plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. FGF-18 is required for normal ossification and bone development. It can also stimulate hepatic and intestinal proliferation. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 1.0 × 10^5units/mg. |
Molecular Mass : | 20.3 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Fibroblast Growth Factor-18 (rhFGF-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-18 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | FGF18 fibroblast growth factor 18 [ Homo sapiens ] |
Official Symbol | FGF18 |
Synonyms | FGF18; fibroblast growth factor 18; FGF 18; ZFGF5; FGF-18; |
Gene ID | 8817 |
mRNA Refseq | NM_003862 |
Protein Refseq | NP_003853 |
MIM | 603726 |
UniProt ID | O76093 |
◆ Recombinant Proteins | ||
Fgf18-588R | Recombinant Rat Fgf18 protein | +Inquiry |
FGF18-3222H | Recombinant Human FGF18 Protein (Cys10-Arg199), His tagged | +Inquiry |
FGF18-4817HF | Recombinant Full Length Human FGF18 Protein, GST-tagged | +Inquiry |
FGF18-183H | Recombinant Human FGF18 protein, His/S-tagged | +Inquiry |
Fgf18-416F | Active Recombinant Rat Fgf18 Protein (172 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF18-1660HCL | Recombinant Human FGF18 cell lysate | +Inquiry |
FGF18-2430MCL | Recombinant Mouse FGF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF18 Products
Required fields are marked with *
My Review for All FGF18 Products
Required fields are marked with *
0
Inquiry Basket