Recombinant Mouse Fgf10 protein

• Cat.No.: Fgf10-561M
• Product Overview: Recombinant Mouse Fgf10 protein was expressed in Escherichia coli.

Specification

• Description: Fibroblast growth factor 10 belongs to the fibroblast growth factor (FGF) family, which is involved in a variety of biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Like most other FGF family members, FGF-10 also has a heparin-binding domain and plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. In addition, FGF-10 may take parts in wound healing and is required for normal branching morphogenesis. Recombinant murine FGF-10 contains a 173 amino acids and it shares 94 % and 100 % a.a. sequence identity with human and rat FGF-10.
• Source: E.coli
• Species: Mouse
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, 600 mM NaCl, pH 7.4, 1 mM mercaptoethanol.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately19.5 kDa, a single non-glycosylated polypeptide chain containing 173 amino acids.
• Protein length: 173
• AA Sequence: QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
• Endotoxin: Less than 1 EU/µg of rMuKGF-2/FGF-10 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: Fgf10
• Official Symbol: Fgf10
• Synonyms: FGF10; fibroblast growth factor 10; keratinocyte growth factor 2; Fgf-10; BB213776
• Gene ID: 14165
• mRNA Refseq: NM_008002
• Protein Refseq: NP_032028
• UniProt ID: O35565