Recombinant Human FGF10 protein

• Cat.No.: FGF10-26205TH
• Product Overview: Recombinant Human FGF10 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 169
• Description: Fibroblast growth factor 10 belongs to the fibroblast growth factor (FGF) family which is involved in a variety of biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. Like most other FGF family members, FGF-10 also has a heparin-binding domain and it plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. In addition, FGF-10 may play a role in wound healing and is required for normal branching morphogenesis. Recombinant human FGF-10 contains a 208 amino acids and it shares 92 % and 95 % amino acid sequence identity with murine and rat FGF-10. Defects in FGF-10 are the cause of autosomal dominant aplasia of lacrimal and salivary glands and lacrimo-auriculo-dento-digital syndrome.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
• Molecular Mass: Approximately 19.1 kDa, a single, non-glycosylated polypeptide chain containing 169 amino acids.
• AA Sequence: LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
• Endotoxin: Less than 1 EU/µg of rHuKGF-2/FGF-10 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FGF10
• Official Symbol: FGF10
• Synonyms: FGF10; fibroblast growth factor 10; FGF-10; keratinocyte growth factor 2; produced by fibroblasts of urinary bladder lamina propria
• Gene ID: 2255
• mRNA Refseq: NM_004465
• Protein Refseq: NP_004456
• MIM: 602115
• UniProt ID: O15520