Recombinant Mouse Egf Protein, His-tagged
Cat.No. : | Egf-7197M |
Product Overview : | Recombinant mouse EGF protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 977-1029 |
Description : | This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. |
Form : | Liquid |
Molecular Mass : | 8.6 kDa (77aa) |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 2 mM DTT, 10 % glycerol, 100 mM NaCl |
Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
Official Symbol | Egf |
Synonyms | Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF) |
Gene ID | 13645 |
mRNA Refseq | NM_001310737 |
Protein Refseq | NP_001297666 |
UniProt ID | Q3UWD7 |
◆ Recombinant Proteins | ||
Egf-427E | Active Recombinant Mouse Egf Protein (54 aa) | +Inquiry |
EGF-61H | Recombinant Active Human EGF Protein, Fc-His-tagged(C-ter) | +Inquiry |
EGF-547H | Active Recombinant Mouse Epidermal Growth Factor, HIgG1 Fc-tagged | +Inquiry |
Egf-05H | Recombinant Murine Epidermal Growth Factor | +Inquiry |
EGF-023H | Active Recombinant Human EGF Protein | +Inquiry |
◆ Native Proteins | ||
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Egf Products
Required fields are marked with *
My Review for All Egf Products
Required fields are marked with *
0
Inquiry Basket