Active Recombinant Rat Egf Protein (54 aa)

• Cat.No.: Egf-013E
• Product Overview: Recombinant Rat Egf Protein without tag was expressed in E. coli.

Specification

• Description: EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor).
• Source: E. coli
• Species: Rat
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 was determined by a cell proliferation assay using BALB/c 3T3 cells is < 0.1 ng/mL, corresponding to a specific activity of > 1 × 10^7 units/mg.
• Molecular Mass: 6.2 kDa, a single non-glycosylated polypeptide chain containing 54 amino acids, including 3 intramolecular disulfide-bonds.
• Protein length: 54
• AA Sequence: MNSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR
• Endotoxin: Less than 1 EU/mg of rRtEGF as determined by LAL method.
• Purity: 97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Egf epidermal growth factor [ Rattus norvegicus ]
• Official Symbol: Egf
• Synonyms: EGF; epidermal growth factor; pro-epidermal growth factor
• Gene ID: 25313
• mRNA Refseq: NM_012842
• Protein Refseq: NP_036974
• UniProt ID: P07522