Active Recombinant Human EGF Protein (54 aa)

Cat.No. : EGF-428E
Product Overview : Recombinant human Epidermal Growth Factor (rhEGF) produced in E. coli is a non-glycosylated polypeptide chain of 54 amino acids. A fully biologically active molecule, rhEGF has a molecular mass of 6.2 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 54
Description : Epidermal Growth Factor (EGF) is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor).
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.6 ng/mL, measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblasts in serum-free medium and CellTiter-Glo cell viability assay, corresponding to a specific activity of >1.7 6 units/mg.
Molecular Mass : 6.2kDa, observed by reducing SDS-PAGE.
AA Sequence : MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Endotoxin : Less than 0.1 ng/μg (1 EU/μg) determined by LAL test
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant human Epidermal Growth Factor (rhEGF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhEGF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade.
Storage Buffer : Lyophilized from a 0.2 μm filtered solution in 10mM PB, pH 7.0
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name EGF epidermal growth factor [ Homo sapiens ]
Official Symbol EGF
Synonyms EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID 1950
mRNA Refseq NM_001178130
Protein Refseq NP_001171601
MIM 131530
UniProt ID P01133

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EGF Products

Required fields are marked with *

My Review for All EGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon