Active Recombinant Human EGF Protein (54 aa)
Cat.No. : | EGF-428E |
Product Overview : | Recombinant human Epidermal Growth Factor (rhEGF) produced in E. coli is a non-glycosylated polypeptide chain of 54 amino acids. A fully biologically active molecule, rhEGF has a molecular mass of 6.2 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 54 |
Description : | Epidermal Growth Factor (EGF) is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.6 ng/mL, measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblasts in serum-free medium and CellTiter-Glo cell viability assay, corresponding to a specific activity of >1.7 6 units/mg. |
Molecular Mass : | 6.2kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Endotoxin : | Less than 0.1 ng/μg (1 EU/μg) determined by LAL test |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human Epidermal Growth Factor (rhEGF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhEGF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered solution in 10mM PB, pH 7.0 |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
◆ Recombinant Proteins | ||
EGF-556H | Active Recombinant Human Epidermal Growth Factor | +Inquiry |
EGF-1079C | Recombinant Chicken EGF | +Inquiry |
EGF-2169H | Active Recombinant Human EGF protein, His-tagged | +Inquiry |
EGF-2215F | Recombinant Feline EGF protein, hFc-tagged | +Inquiry |
EGF-2810D | Recombinant Dog EGF protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Egf-634M | Active Native Mouse Egf | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
0
Inquiry Basket