Recombinant Mouse Egf Protein, His-tagged
Cat.No. : | Egf-054M |
Product Overview : | Purified recombinant protein of Mouse epidermal growth factor with C-terminal His tag, expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. |
Molecular Mass : | 7.1 kDa |
AA Sequence : | NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELRLEHHHHHH |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.2 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Egf epidermal growth factor [ Mus musculus (house mouse) ] |
Official Symbol | Egf |
Synonyms | Egf; epidermal growth factor; AI790464; pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF) |
Gene ID | 13645 |
mRNA Refseq | NM_010113 |
Protein Refseq | NP_034243 |
UniProt ID | P01132 |
◆ Recombinant Proteins | ||
EGF-11750Z | Recombinant Zebrafish EGF | +Inquiry |
AMER1-7844H | Recombinant Human AMER1 protein, His-tagged | +Inquiry |
EGF-9H | Active Recombinant human EGF | +Inquiry |
EGF-06H | Recombinant Human epidermal growth factor Protein, Tag Free, Animal Free | +Inquiry |
EGF-561M | Active Recombinant Mouse Epidermal Growth Factor, MIgG2a Fc-tagged, mutant | +Inquiry |
◆ Native Proteins | ||
EGF-26462TH | Native Human EGF | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Egf Products
Required fields are marked with *
My Review for All Egf Products
Required fields are marked with *
0
Inquiry Basket