Recombinant Mouse Efnb3 protein, His-tagged
Cat.No. : | Efnb3-2838M |
Product Overview : | Recombinant Mouse Efnb3 protein(O35393)(28-227aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-227aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26 kDa |
AA Sequence : | LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Efnb3 ephrin B3 [ Mus musculus ] |
Official Symbol | Efnb3 |
Synonyms | EFNB3; ephrin B3; ephrin-B3; Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2; |
Gene ID | 13643 |
mRNA Refseq | NM_007911 |
Protein Refseq | NP_031937 |
◆ Recombinant Proteins | ||
Efnb3-957M | Active Recombinant Mouse Efnb3 Protein, Fc Chimera | +Inquiry |
EFNB3-3106H | Recombinant Human EFNB3 Protein, His-tagged | +Inquiry |
EFNB3-1612H | Recombinant Human EFNB3 | +Inquiry |
Efnb3-8717R | Active Recombinant Rat Efnb3 protein, His-tagged | +Inquiry |
EFNB3-153H | Recombinant Human Ephrin-B3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB3-1264RCL | Recombinant Rat EFNB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Efnb3 Products
Required fields are marked with *
My Review for All Efnb3 Products
Required fields are marked with *
0
Inquiry Basket