Recombinant Mouse Dbi protein, His&Myc-tagged
Cat.No. : | Dbi-2800M |
Product Overview : | Recombinant Mouse Dbi protein(P31786)(2-87aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-87aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.9 kDa |
AA Sequence : | SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Dbi diazepam binding inhibitor [ Mus musculus ] |
Official Symbol | Dbi |
Synonyms | DBI; diazepam binding inhibitor; acyl-CoA-binding protein; acyl-CoA binding protein; diazepam-binding inhibitor; diazepam binding inhibitor, splice form 1b; EP; Acbp; ACBD1; endozepine; |
Gene ID | 13167 |
mRNA Refseq | NM_001037999 |
Protein Refseq | NP_001033088 |
◆ Recombinant Proteins | ||
Dbi-2800M | Recombinant Mouse Dbi protein, His&Myc-tagged | +Inquiry |
Dbi-3133R | Recombinant Rat Dbi, GST-tagged | +Inquiry |
DBI-301619H | Recombinant Human DBI protein, GST-tagged | +Inquiry |
Dbi-688M | Recombinant Mouse Dbi protein, His&Myc-tagged | +Inquiry |
ACBP-3046H | Recombinant Human ACBP, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DBI-7066HCL | Recombinant Human DBI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Dbi Products
Required fields are marked with *
My Review for All Dbi Products
Required fields are marked with *
0
Inquiry Basket