Recombinant Mouse Cyld protein, His&Myc-tagged

• Cat.No.: Cyld-653M
• Product Overview: Recombinant Mouse Cyld protein(Q80TQ2)(579-952aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Mouse
• Tag: N-His&C-Myc
• Protein length: 579-952aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.6 kDa
• AASequence: GLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSALDTVLLRPKEKNDIEYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHDILRVEPLLKIRSAGQKVQDCNFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCSTQVHLHPRRLNHSYHPVSLPKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Cyld cylindromatosis (turban tumor syndrome) [ Mus musculus ]
• Official Symbol: Cyld
• Synonyms: CYLD; cylindromatosis (turban tumor syndrome); ubiquitin carboxyl-terminal hydrolase CYLD; ubiquitin thioesterase CYLD; deubiquitinating enzyme CYLD; ubiquitin thiolesterase CYLD; ubiquitin-specific-processing protease CYLD; probable ubiquitin carboxyl-terminal hydrolase CYLD; EAC; CDMT; CYLD1; mKIAA0849; 2010013M14Rik; 2900009M21Rik; C130039D01Rik
• Gene ID: 74256
• mRNA Refseq: NM_001128169
• Protein Refseq: NP_001121641