Recombinant Mouse Cxcr2 Full Length Transmembrane protein, His-tagged

• Cat.No.: Cxcr2-1314M
• Product Overview: Recombinant Mouse Cxcr2 protein(P35343)(1-359aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: In vitro E. coli expression system
• Species: Mouse
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.2 kDa
• Protein length: 1-359aa
• AA Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINSYAVVVIYVLVTLL SLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWAASKVNGWTFGSTLCKI FSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKFVCIAMWLLSVILALPIL ILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVPLLIMLFCYGFTLRTLFKA HMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLIKETCERRDDIDKALNATEI LGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLAKEGRPSFVSSSSANTSTTL
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cxcr2 chemokine (C-X-C motif) receptor 2 [ Mus musculus ]
• Official Symbol: Cxcr2
• Synonyms: CXCR2; chemokine (C-X-C motif) receptor 2; C-X-C chemokine receptor type 2; CXC-R2; CXCR-2; IL-8R B; GRO/MGSA receptor; IL-8 receptor alpha chain; chemokine (C-X-C) receptor 2; interleukin 8 receptor, beta; interleukin-8 receptor type B; high affinity interleukin-8 receptor B; CD128; IL8RA; Il8rb; CDw128; Cmkar2; Gpcr16; IL-8Rh; IL-8rb; mIL-8RH
• Gene ID: 12765
• mRNA Refseq: NM_009909
• Protein Refseq: NP_034039