Recombinant Mouse Cxcl11 protein

Cat.No. : Cxcl11-95M
Product Overview : Recombinant Mouse Cxcl11 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 79
Description : Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 10 mM Sodium Citrate, pH 4.0, with 600 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine CXCR3 transfected 293 cells is in a concentration of 10-100 ng/ml.
Molecular Mass : Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 79 amino acids.
AA Sequence : FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Endotoxin : Less than 1 EU/µg of rMuI-TAC/CXCL11 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl11
Official Symbol Cxcl11
Synonyms CXCL11; chemokine (C-X-C motif) ligand 11; C-X-C motif chemokine 11; small-inducible cytokine B11; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1;
Gene ID 56066
mRNA Refseq NM_019494
Protein Refseq NP_062367
UniProt ID Q9JHH5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cxcl11 Products

Required fields are marked with *

My Review for All Cxcl11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon