Recombinant Human CXCL11, StrepII-tagged

Cat.No. : CXCL11-297H
Product Overview : Purified, full-length human recombinant CXCL11 protein (amino acids 22-94, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 8.3 kDa. (Accession NP_005400; UniProt O14625)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 22-94, 73 a.a.
Description : CXCL11 is a member of the intercrine alpha (chemokine CxC) family. It is chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. This protein induces calcium release in activated T-cells and binds to CXCR3. It may play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Endotoxin : <0.1 eu per μg protein by lal
Purity : ~80% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.
Gene Name CXCL11 chemokine (C-X-C motif) ligand 11 [ Homo sapiens ]
Official Symbol CXCL11
Synonyms CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770;
Gene ID 6373
mRNA Refseq NM_005409
Protein Refseq NP_005400
MIM 604852
UniProt ID O14625
Chromosome Location 4q21
Pathway CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function chemokine activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL11 Products

Required fields are marked with *

My Review for All CXCL11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon