Recombinant Human CXCL11, StrepII-tagged

• Cat.No.: CXCL11-297H
• Product Overview: Purified, full-length human recombinant CXCL11 protein (amino acids 22-94, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 8.3 kDa. (Accession NP_005400; UniProt O14625)

Specification

• Description: CXCL11 is a member of the intercrine alpha (chemokine CxC) family. It is chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. This protein induces calcium release in activated T-cells and binds to CXCR3. It may play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• Protein length: 22-94, 73 a.a.
• AA Sequence: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: ~80% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for up to 1 month.

Gene Information

• Gene Name: CXCL11 chemokine (C-X-C motif) ligand 11 [ Homo sapiens ]
• Official Symbol: CXCL11
• Synonyms: CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770
• Gene ID: 6373
• mRNA Refseq: NM_005409
• Protein Refseq: NP_005400
• MIM: 604852
• UniProt ID: O14625
• Chromosome Location: 4q21
• Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
• Function: chemokine activity