Recombinant Mouse Cxcl1 Protein, His-tagged

Cat.No. : Cxcl1-7216M
Product Overview : Recombinant Mouse Cxcl1 protein with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 25-96
Description : This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
Form : Liquid
Molecular Mass : 10.5 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSHMAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol 0.1 M NaCl
Gene Name Cxcl1 chemokine (C-X-C motif) ligand 1 [ Mus musculus (house mouse) ]
Official Symbol Cxcl1
Synonyms Cxcl1; chemokine (C-X-C motif) ligand 1; F; Gr; KC; Mg; N5; Fsp; N51; gro; Gro1; Mgsa; Scyb; Scyb1; growth-regulated alpha protein; C-X-C motif chemokine 1; GRO1 oncogene; KC/GR)-alpha; KC/GRO-alpha; alpha-chemokine; platelet-derived growth factor-inducible protein KC; secretory protein N51
Gene ID 14825
mRNA Refseq NM_008176
Protein Refseq NP_032202
UniProt ID P12850

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Cxcl1 Products

Required fields are marked with *

My Review for All Cxcl1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon