Recombinant Mouse Cxcl1 Protein, His-tagged

• Cat.No.: Cxcl1-7216M
• Product Overview: Recombinant Mouse Cxcl1 protein with a His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 25-96
• Description: This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung.
• Form: Liquid
• Molecular Mass: 10.5 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol 0.1 M NaCl

Gene Information

• Gene Name: Cxcl1 chemokine (C-X-C motif) ligand 1 [ Mus musculus (house mouse) ]
• Official Symbol: Cxcl1
• Synonyms: Cxcl1; chemokine (C-X-C motif) ligand 1; F; Gr; KC; Mg; N5; Fsp; N51; gro; Gro1; Mgsa; Scyb; Scyb1; growth-regulated alpha protein; C-X-C motif chemokine 1; GRO1 oncogene; KC/GR)-alpha; KC/GRO-alpha; alpha-chemokine; platelet-derived growth factor-inducible protein KC; secretory protein N51
• Gene ID: 14825
• mRNA Refseq: NM_008176
• Protein Refseq: NP_032202
• UniProt ID: P12850