Active Recombinant Human CXCL1 Protein

• Cat.No.: CXCL1-272C
• Product Overview: Recombinant Human CXCL1 Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: GRO/MGSA/CXCL1 has chemotactic activity for neutrophils. It may play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. All three isoforms of GRO are CXC chemokines that can signal through the CXCR1 or CXCR2 receptors. GRO expression is inducible by serum or PDGF and/or by a variety of inflammatory mediators, such as IL-1 and TNF, in monocytes, fibroblasts, melanocytes and epithelial cells. In certain tumor cell lines, GRO is expressed constitutively.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Active, measured in a functional assay using HUVEC cells.
• Molecular Mass: ~7.8 kDa, observed by reducing SDS-PAGE.
• AA Sequence: ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human GRO/MGSA/CXCL1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human GRO/MGSA/CXCL1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: CXCL1 chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) [ Homo sapiens ]
• Official Symbol: CXCL1
• Synonyms: CXCL1; chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha); fibroblast secretory protein, FSP, GRO1, GRO1 oncogene (melanoma growth stimulating activity, alpha), MGSA; growth-regulated alpha protein; GROa; MGSA a; NAP 3; SCYB1; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 oncogene (melanoma growth stimulating activity, alpha); FSP; GRO1; MGSA; NAP-3; MGSA-a
• Gene ID: 2919
• mRNA Refseq: NM_001511
• Protein Refseq: NP_001502
• MIM: 155730
• UniProt ID: P09341