Recombinant Mouse Ctss Protein, His-tagged

Cat.No. : Ctss-7189M
Product Overview : Recombinant Mouse Ctss Protein with a His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : His
Protein Length : 21-340 (325aa)
Description : This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, which encode preproproteins that are proteolytically processed to generate mature protein products. This enzyme is secreted by antigen-presenting cells during inflammation and may induce pain and itch via activation of G-protein coupled receptors. Homozygous knockout mice for this gene exhibit impaired wound healing, reduced tumorigenesis in a pancreatic cancer model, and reduced pathogenesis in a myasthenia gravis model.
Form : Liquid
Molecular Mass : 36.9 kDa
AA Sequence : EQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEISCRMGALRISRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEILEHHHHHHDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEILEHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Ctss cathepsin S [ Mus musculus (house mouse) ]
Official Symbol Ctss
Synonyms Ctss; cathepsin S; Cats; cathepsin S; Cat S; EC 3.4.22.27
Gene ID 13040
mRNA Refseq NM_001267695
Protein Refseq NP_001254624
UniProt ID F6WR04

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ctss Products

Required fields are marked with *

My Review for All Ctss Products

Required fields are marked with *

0

Inquiry Basket

cartIcon