Recombinant Mouse Csf1 protein

• Cat.No.: Csf1-100M
• Product Overview: Recombinant Mouse Csf1 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 230
• Description: Macrophage Colony Stimulating Factor (M-CSF), also named CSF-1, is a hematopoietic growth factor that is involved in the proliferation, differentiation, and survival of monocytes, macrophages, and bone marrow progenitor cells. It is produced by osteoblasts (as a result of endocrine stimulation by parathyroid hormone) exerts paracrine effects on osteoclasts and can interact with CSF1R. M-CSF is a four α-helical bundle cytokine and its active form is found extracellularly as a disulfide-linked homodimer. Four transcript variants encoding three different isoforms have been reported for M-CSF gene. Although forms may vary, all of them contain the N-terminal 150 a.a. portion that is necessary and sufficient for interaction with the receptor. The first 229 a.a. of mature mouse M-CSF shares 87 %, 83 %, 82 % and 81 % sequence identity with corresponding regions of rat, dog, cow and human M-CSF, respectively. Human M-CSF is active in the mouse, but mouse M-CSF is reported to be species-specific.
• Form: Lyophilized from a 0.2μm filtered solution in 20 mM Tris, 500 mM NaCl, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine M-NFS-60 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 52.0 kDa, a disulfide-linked homodimer consisting of two 230 amino acid polypeptide chains.
• AA Sequence: KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
• Endotoxin: Less than 1 EU/μg of rMuM-CSF as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Csf1
• Official Symbol: Csf1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; osteopetrosis; op; Csfm; MCSF; C87615
• Gene ID: 12977
• mRNA Refseq: NM_001113529
• Protein Refseq: NP_001107001
• UniProt ID: Q3U4F9