Active Recombinant Rat Csf1

• Cat.No.: Csf1-12R
• Product Overview: Recombinant Rat Csf1 was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: Non
• Description: The colony stimulating factor 1 (CSF1), also known as macrophage colony-stimulating factor (M-CSF), is a secreted cytokine which influences hematopoietic stem cells to differentiate into macrophages or other related cell types. Eukaryotic cells also produce M-CSF in order to combat intercellular viral infection. (See colony-stimulating factor.) M-CSF binds to the Colony stimulating factor 1 receptor. It may also be involved in development of the placenta.
• Bio-activity: ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg.
• Molecular Mass: 18.1 kDa
• AA Sequence: MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNAN ATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRD VVTKP
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Csf1
• Synonyms: Csf1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; CSF-1; MCSF; NP_076471.3; EC 2.7.10.1
• Gene ID: 78965
• mRNA Refseq: NM_023981
• Protein Refseq: NP_076471
• UniProt ID: Q8JZQ0
• Chromosome Location: 2q34
• Pathway: Cytokine-cytokine receptor interaction; Cytokines and Inflammatory Response (BioCarta); Hematopoietic cell lineage
• Function: cytokine activity; growth factor activity; macrophage colony-stimulating factor receptor binding