Active Recombinant Rat Csf1
Cat.No. : | Csf1-12R |
Product Overview : | Recombinant Rat Csf1 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Description : | The colony stimulating factor 1 (CSF1), also known as macrophage colony-stimulating factor (M-CSF), is a secreted cytokine which influences hematopoietic stem cells to differentiate into macrophages or other related cell types. Eukaryotic cells also produce M-CSF in order to combat intercellular viral infection. (See colony-stimulating factor.) M-CSF binds to the Colony stimulating factor 1 receptor. It may also be involved in development of the placenta. |
Bio-activity : | ED50 was determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells is less than or equal to 5.0 ng/ml, corresponding to a specific activity of >2 x 10^5 units/mg. |
Molecular Mass : | 18.1 kDa |
AA Sequence : | MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNAN ATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRD VVTKP |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | Csf1 colony stimulating factor 1 (macrophage) [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Csf1 |
Synonyms | Csf1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; CSF-1; MCSF; NP_076471.3; EC 2.7.10.1 |
Gene ID | 78965 |
mRNA Refseq | NM_023981 |
Protein Refseq | NP_076471 |
UniProt ID | Q8JZQ0 |
Chromosome Location | 2q34 |
Pathway | Cytokine-cytokine receptor interaction; Cytokines and Inflammatory Response (BioCarta); Hematopoietic cell lineage |
Function | cytokine activity; growth factor activity; macrophage colony-stimulating factor receptor binding |
◆ Recombinant Proteins | ||
CSF1-32H | Active Recombinant Human CSF1, His-tagged | +Inquiry |
CSF1-083C | Active Recombinant Human CSF1 Protein (1-149 aa) | +Inquiry |
Csf1-1106M | Recombinant Mouse Csf1 Protein, His-tagged | +Inquiry |
Csf1-041M | Active Recombinant Mouse Csf1 Protein | +Inquiry |
CSF1-27H | Active Recombinant Human CSF1 Protein (Glu33-Ser190), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1-001MCL | Recombinant Mouse CSF1 cell lysate | +Inquiry |
CSF1-1934HCL | Recombinant Human CSF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Csf1 Products
Required fields are marked with *
My Review for All Csf1 Products
Required fields are marked with *
0
Inquiry Basket