Recombinant Mouse CNRIP1 Protein (1-464 aa), His-Myc-tagged

Cat.No. : CNRIP1-2629M
Product Overview : Recombinant Mouse CNRIP1 Protein (1-464 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Form : Tris-based buffer,50% glycerol
Molecular Mass : 22.6 kDa
Protein length : 1-464 aa
AA Sequence : MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Cnrip1 cannabinoid receptor interacting protein 1 [ Mus musculus ]
Official Symbol CNRIP1
Synonyms CNRIP1; CRIP-1; C2orf32; AI854501; RP23-348N2.3; 1500041B16Rik; 3110054C06Rik; 5330437A18Rik;
Gene ID 380686
mRNA Refseq NM_029861
Protein Refseq NP_084137
UniProt ID Q5M8N0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CNRIP1 Products

Required fields are marked with *

My Review for All CNRIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon