Recombinant Full Length Human CNRIP1 Protein, GST-tagged

• Cat.No.: CNRIP1-1960HF
• Product Overview: Human CNRIP1 full-length ORF (BAG34727.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that interacts with the C-terminal tail of cannabinoid receptor 1. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2013]
• Molecular Mass: 44.44 kDa
• Protein length: 164 amino acids
• AA Sequence: MGDLPGLVRLSIALRIQPNDGPVFYKVDGQRFGQNRTIKLLTGSSYKVEVKIKPSTLQVENISIGGVLVPLELKSKEPDGDRVVYTGTYDTEGVTPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNRIP1 cannabinoid receptor interacting protein 1 [ Homo sapiens ]
• Official Symbol: CNRIP1
• Synonyms: CNRIP1; cannabinoid receptor interacting protein 1; C2orf32, chromosome 2 open reading frame 32; CB1 cannabinoid receptor-interacting protein 1; CRIP1; CRIP1a; CRIP1b; DKFZP566K1924; CRIP-1; cannabinoid receptor CB1-interacting protein 1; C2orf32; DKFZp566K1924
• Gene ID: 25927
• mRNA Refseq: NM_015463
• Protein Refseq: NP_056278
• MIM: 618538
• UniProt ID: Q96F85