Recombinant Mouse Chrac1 protein, His&Myc-tagged

• Cat.No.: Chrac1-3423M
• Product Overview: Recombinant Mouse Chrac1 protein(Q9JKP8)(2-129aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: N-His&C-Myc
• ProteinLength: 2-129aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 21.4 kDa
• AASequence: ADAAVGKEKCGDQRLVSLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAEDSETLQFLADILPKKILASKYLKMLKEKREEEEDNEDDGSDLGEALA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Chrac1 chromatin accessibility complex 1 [ Mus musculus ]
• Official Symbol: Chrac1
• Synonyms: CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC-1; YC-like protein 1; NF-YC-like protein; DNA polymerase epsilon subunit p15; YCL1; 2410152E03Rik; 2810406L04Rik
• Gene ID: 93696
• mRNA Refseq: NM_053068
• Protein Refseq: NP_444298