Recombinant Full Length Human CHRAC1 Protein, GST-tagged

• Cat.No.: CHRAC1-3218HF
• Product Overview: Human CHRAC1 full-length ORF (AAH15891, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 131 amino acids
• Description: CHPT1 (Choline Phosphotransferase 1) is a Protein Coding gene. Among its related pathways are phosphatidylcholine biosynthesis and Synthesis of PC. GO annotations related to this gene include diacylglycerol binding and diacylglycerol cholinephosphotransferase activity. An important paralog of this gene is CEPT1.
• Molecular Mass: 40.15 kDa
• AA Sequence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHRAC1 chromatin accessibility complex 1 [ Homo sapiens ]
• Official Symbol: CHRAC1
• Synonyms: CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC15; histone fold protein CHRAC15; YCL1; histone-fold protein CHRAC15; DNA polymerase epsilon subunit p15; chromatin accessibility complex 15 kDa protein; CHARC1; CHARC15; CHRAC-1; CHRAC-15
• Gene ID: 54108
• mRNA Refseq: NM_017444
• Protein Refseq: NP_059140
• MIM: 607268
• UniProt ID: Q9NRG0