Recombinant Mouse Cfi protein, His&Myc-tagged
Cat.No. : | Cfi-2210M |
Product Overview : | Recombinant Mouse Cfi protein(Q61129)(19-603aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 19-603aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 69.2 kDa |
AA Sequence : | RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cfi complement component factor i [ Mus musculus ] |
Official Symbol | Cfi |
Synonyms | CFI; complement component factor i; complement factor I; C3B/C4B inactivator; |
Gene ID | 12630 |
mRNA Refseq | NM_007686 |
Protein Refseq | NP_031712 |
◆ Recombinant Proteins | ||
CFI-4700C | Recombinant Chicken CFI | +Inquiry |
CFI-1053H | Recombinant Human CFI protein, His-tagged | +Inquiry |
CFI-2741H | Recombinant Human CFI protein(239-316aa), His-GST&Myc-tagged | +Inquiry |
Cfi-2210M | Recombinant Mouse Cfi protein, His&Myc-tagged | +Inquiry |
Cfi-880M | Recombinant Mouse Cfi Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CFI-105H | Active Native Human Factor I | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFI-7556HCL | Recombinant Human CFI 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cfi Products
Required fields are marked with *
My Review for All Cfi Products
Required fields are marked with *
0
Inquiry Basket