Description :	Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assbly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. The CENPA-H4 heterotetramer can bind DNA by itself (in vitro).
Source :	Yeast
Species :	Mouse
Tag :	His
Form :	Tris-based buffer,50% glycerol
Molecular Mass :	17.5 kDa
Protein length :	1-134 aa
AA Sequence :	MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP
Purity :	> 90% as determined by SDS-PAGE.
Notes :	Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage :	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration :	A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Name	Cenpa centromere protein A [ Mus musculus ]
Official Symbol	CENPA
Synonyms	CENPA; centrosomin A; Cenp-A;
Gene ID	12615
mRNA Refseq	NM_007681
Protein Refseq	NP_031707
UniProt ID	O35216

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	CENPA-1359M
Product Overview :	Recombinant Mouse CELA2A Protein (1-134 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Recombinant Mouse CELA2A Protein (1-134 aa), His-tagged