Recombinant Human CENPA protein, GST-tagged
Cat.No. : | CENPA-301526H |
Product Overview : | Recombinant Human CENPA (1-59 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-His59 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CENPA centromere protein A [ Homo sapiens ] |
Official Symbol | CENPA |
Synonyms | CENPA; centromere protein A; centromere protein A (17kD) , centromere protein A, 17kDa; histone H3-like centromeric protein A; CenH3; CENP A; centromere specific histone; histone H3 like centromeric protein A; centromere autoantigen A; centromere protein A, 17kDa; centromere-specific histone; CENP-A; |
Gene ID | 1058 |
mRNA Refseq | NM_001042426 |
Protein Refseq | NP_001035891 |
MIM | 117139 |
UniProt ID | P49450 |
◆ Recombinant Proteins | ||
CENPA-6623H | Recombinant Human CENPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CENPA-1575M | Recombinant Mouse CENPA Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPA-617H | Recombinant Human Centromere Protein A, His-tagged | +Inquiry |
CENPA-27391TH | Recombinant Human CENPA, His-tagged | +Inquiry |
CENPA-7573Z | Recombinant Zebrafish CENPA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPA-7587HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CENPA Products
Required fields are marked with *
My Review for All CENPA Products
Required fields are marked with *
0
Inquiry Basket