Recombinant Full Length Human CENPA Protein, GST-tagged

Cat.No. : CENPA-3313HF
Product Overview : Human CENPA full-length ORF (AAH00881, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 114 amino acids
Description : Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Nov 2015]
Molecular Mass : 38.28 kDa
AA Sequence : MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPA centromere protein A [ Homo sapiens ]
Official Symbol CENPA
Synonyms CENPA; centromere protein A; centromere protein A (17kD), centromere protein A, 17kDa; histone H3-like centromeric protein A; CenH3; CENP A; centromere specific histone; histone H3 like centromeric protein A; centromere autoantigen A; centromere protein A, 17kDa; centromere-specific histone; CENP-A;
Gene ID 1058
mRNA Refseq NM_001042426
Protein Refseq NP_001035891
MIM 117139
UniProt ID P49450

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CENPA Products

Required fields are marked with *

My Review for All CENPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon