Recombinant Mouse Cd82 protein, His-SUMO-tagged

• Cat.No.: Cd82-2674M
• Product Overview: Recombinant Mouse Cd82 protein(P40237)(111-227aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 111-227aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.5 kDa
• AA Sequence: DKLKKEMGNTVMDIIRNYTANATSSREEAWDYVQAQVKCCGWVSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCEADNSTVSENNPEDWPVNTEGCMEKAQAWLQENF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Cd82 CD82 antigen [ Mus musculus ]
• Official Symbol: Cd82
• Synonyms: CD82; CD82 antigen; IA4; C33 antigen; inducible membrane protein R2; metastasis suppressor Kangai-1 homolog; kangai 1 (suppression of tumorigenicity 6, prostate); C33; Kai1; Tspan27; AA682076; AL023070
• Gene ID: 12521
• mRNA Refseq: NM_001136055
• Protein Refseq: NP_001129527