Recombinant Mouse CD276 Protein, Fc-tagged

• Cat.No.: CD276-602M
• Product Overview: Recombinant Mouse CD276 protein with Fc tag was expressed in HEK293.

Specification

• Description: Enables identical protein binding activity and signaling receptor binding activity. Acts upstream of or within several processes, including positive regulation of osteoblast differentiation; regulation of T cell proliferation; and regulation of cytokine production. Located in external side of plasma membrane. Is expressed in several structures, including embryo endoderm; genitourinary system; hemolymphoid system; liver; and musculoskeletal system. Orthologous to human CD276 (CD276 molecule).
• Source: HEK293
• Species: Mouse
• Tag: Fc
• Form: Lyophilized
• Molecular Mass: 50.1 kDa
• Protein length: 316
• AA Sequence: MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Cd276 CD276 antigen [ Mus musculus (house mouse) ]
• Official Symbol: CD276
• Synonyms: CD276; CD276 antigen; B7-H3; B7 homolog 3; costimulatory molecule; B7h3; B7RP-2; AU016588; 6030411F23Rik
• Gene ID: 102657
• mRNA Refseq: NM_133983
• Protein Refseq: NP_598744
• UniProt ID: Q8VE98