Recombinant Mouse Ccl3 Protein, His-tagged

• Cat.No.: Ccl3-7337M
• Product Overview: Recombinant mouse CCL3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 24-92
• Description: Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.
• Form: Liquid
• Molecular Mass: 10.4 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Sodium citrate buffer (pH 3.5) containing 10 % glycerol

Gene Information

• Gene Name: Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl3
• Synonyms: Ccl3; chemokine (C-C motif) ligand 3; Mi; CCL; Scy; LD78; MIP-; MIP1; MIP1-; Mip1a; Scya3; G0S19-; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha; C-C motif chemokine 3; L2G25B; MIP-1-alpha; MIP1 (a); SIS-alpha; TY-5; heparin-binding chemotaxis protein; macrophage inflammatory protein 1-alpha; macrophage inflammatory protein-1alpha; small-inducible cytokine A3
• Gene ID: 20302
• mRNA Refseq: NM_011337
• Protein Refseq: NP_035467
• UniProt ID: P10855