Recombinant Human CCL3, StrepII-tagged

Cat.No. : CCL3-276H
Product Overview : Purified, full-length human recombinant CCL3 protein (amino acids 24-92, 69 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 10.3 kDa. (Accession NP_002974; UniProt P10147)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 24-92, 69 a.a.
Description : CCL3 is a small inducible cytokine belonging to the CC chemokine family. Also know as macrophage inflammatory protein 1 alpha (MIP-1-alpha), this protein plays a role in inflammatory responses through binding to the receptors CCR1, CCR4, and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Endotoxin : <0.1 eu per μg protein by lal
Purity : >90% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ]
Official Symbol CCL3
Synonyms CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha;
Gene ID 6348
mRNA Refseq NM_002983
Protein Refseq NP_002974
MIM 182283
UniProt ID P10147
Chromosome Location 17q12
Pathway Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function CCR1 chemokine receptor binding; CCR5 chemokine receptor binding; calcium-dependent protein kinase C activity; chemoattractant activity; chemokine activity; kinase activity; phospholipase activator activity; protein binding; protein kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL3 Products

Required fields are marked with *

My Review for All CCL3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon