Recombinant Human CCL3, StrepII-tagged
Cat.No. : | CCL3-276H |
Product Overview : | Purified, full-length human recombinant CCL3 protein (amino acids 24-92, 69 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 10.3 kDa. (Accession NP_002974; UniProt P10147) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 24-92, 69 a.a. |
Description : | CCL3 is a small inducible cytokine belonging to the CC chemokine family. Also know as macrophage inflammatory protein 1 alpha (MIP-1-alpha), this protein plays a role in inflammatory responses through binding to the receptors CCR1, CCR4, and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ] |
Official Symbol | CCL3 |
Synonyms | CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha; |
Gene ID | 6348 |
mRNA Refseq | NM_002983 |
Protein Refseq | NP_002974 |
MIM | 182283 |
UniProt ID | P10147 |
Chromosome Location | 17q12 |
Pathway | Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function | CCR1 chemokine receptor binding; CCR5 chemokine receptor binding; calcium-dependent protein kinase C activity; chemoattractant activity; chemokine activity; kinase activity; phospholipase activator activity; protein binding; protein kinase activity; |
◆ Recombinant Proteins | ||
CCL3-78H | Recombinant Human CCL3 Protein, Biotin-tagged | +Inquiry |
CCL3-79H | Recombinant Human Chemokine (C-C motif) Ligand 3 | +Inquiry |
CCL3-871R | Recombinant Rat CCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL3-519R | Recombinant Rhesus Macaque CCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL3-1491H | Recombinant Human CCL3 Protein (Ser24-Ala92), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL3 Products
Required fields are marked with *
My Review for All CCL3 Products
Required fields are marked with *
0
Inquiry Basket