Recombinant Mouse Ccl24 protein

Cat.No. : Ccl24-475M
Product Overview : Recombinant Mouse Ccl24 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 93
Description : CCL24, also named MPIF-2, Eotaxin-2 and Ckβ6, is a novel CC chemokine recently identified. It is a secreted protein, encoded by CCL24 gene, and produced by activated monocytes and T lymphocytes. CCL24 signals through the CCR3 receptor and has functions of chemotactic activity for resting T-lymphocytes and eosinophils, but none for monocytes and activated lymphocytes. The plasma levels of CCL24 and the aspirin-exacerbated respiratory disease (such as asthma) morbidity rate have positive correlation.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 10-100 ng/ml.
Molecular Mass : Approximately 10.3 kDa, a single, non-glycosylated polypeptide chain containing 93 amino acids.
AA Sequence : VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Endotoxin : Less than 1 EU/μg of rMuEotaxin-2/CCL24 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl24
Official Symbol Ccl24
Synonyms CCL24; chemokine (C-C motif) ligand 24; C-C motif chemokine 24; eotaxin-2; CC chemokine CCL24; small inducible cytokine A24; small-inducible cytokine A24; eosinophil chemotactic protein 2; CKb-6; MPIF-2; Scya24;
Gene ID 56221
mRNA Refseq NM_019577
Protein Refseq NP_062523
UniProt ID Q9JKC0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Ccl24 Products

Required fields are marked with *

My Review for All Ccl24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon