Active Recombinant Mouse Ccl24 Protein

• Cat.No.: Ccl24-151M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 24 (Ccl24) without tag was expressed in E.coli.

Specification

• Description: Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Binds to CCR3.
• Source: E. coli
• Species: Mouse
• Bio-activity: Determined by its ability to chemoattract murine lymphocytes using a concentration range of 10-100 ng/ml.
• Molecular Mass: 10.3 kDa
• AA Sequence: VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl24 chemokine (C-C motif) ligand 24 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl24
• Synonyms: Ccl24; chemokine (C-C motif) ligand 24; CKb-6; MPIF-2; Scya24; C-C motif chemokine 24; CC chemokine CCL24; eosinophil chemotactic protein 2; eotaxin-2; small-inducible cytokine A24
• Gene ID: 56221
• mRNA Refseq: NM_019577
• Protein Refseq: NP_062523
• UniProt ID: Q9JKC0