Recombinant Mouse CAMK2N1 Protein (1-78 aa), His-SUMO-tagged
| Cat.No. : | CAMK2N1-378M |
| Product Overview : | Recombinant Mouse CAMK2N1 Protein (1-78 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | Potent and specific inhibitor of CaM-kinase II (CAMK2). |
| Source : | E. coli |
| Species : | Mouse |
| Tag : | His&SUMO |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 24.5 kDa |
| Protein length : | 1-78 aa |
| AA Sequence : | MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Camk2n1 calcium/calmodulin-dependent protein kinase II inhibitor 1 [ Mus musculus (house mouse) ] |
| Official Symbol | CAMK2N1 |
| Synonyms | AI848599; AI891706; 1810006K23Rik; |
| Gene ID | 66259 |
| mRNA Refseq | NM_025451 |
| Protein Refseq | NP_079727 |
| UniProt ID | Q6QWF9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAMK2N1 Products
Required fields are marked with *
My Review for All CAMK2N1 Products
Required fields are marked with *
0
Inquiry Basket
